KCNK10 monoclonal antibody (M03), clone 1C1
  • KCNK10 monoclonal antibody (M03), clone 1C1

KCNK10 monoclonal antibody (M03), clone 1C1

Ref: AB-H00054207-M03
KCNK10 monoclonal antibody (M03), clone 1C1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KCNK10.
Información adicional
Size 100 ug
Gene Name KCNK10
Gene Alias FLJ43399|K2p10.1|TREK-2|TREK2
Gene Description potassium channel, subfamily K, member 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELENGMIPTDTKDREPENNSLLEDRN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KCNK10 (NP_066984, 439 a.a. ~ 538 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54207
Clone Number 1C1
Iso type IgG1 Kappa

Enviar un mensaje


KCNK10 monoclonal antibody (M03), clone 1C1

KCNK10 monoclonal antibody (M03), clone 1C1