CYCS purified MaxPab rabbit polyclonal antibody (D01P)
  • CYCS purified MaxPab rabbit polyclonal antibody (D01P)

CYCS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00054205-D01P
CYCS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CYCS protein.
Información adicional
Size 100 ug
Gene Name CYCS
Gene Alias CYC|HCS
Gene Description cytochrome c, somatic
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CYCS (NP_061820.1, 1 a.a. ~ 105 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54205

Enviar un mensaje


CYCS purified MaxPab rabbit polyclonal antibody (D01P)

CYCS purified MaxPab rabbit polyclonal antibody (D01P)