CYCS MaxPab mouse polyclonal antibody (B01P)
  • CYCS MaxPab mouse polyclonal antibody (B01P)

CYCS MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054205-B01P
CYCS MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CYCS protein.
Información adicional
Size 50 ug
Gene Name CYCS
Gene Alias CYC|HCS
Gene Description cytochrome c, somatic
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CYCS (AAH05299, 1 a.a. ~ 105 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54205

Enviar un mensaje


CYCS MaxPab mouse polyclonal antibody (B01P)

CYCS MaxPab mouse polyclonal antibody (B01P)