NANS monoclonal antibody (M01), clone 3G6
  • NANS monoclonal antibody (M01), clone 3G6

NANS monoclonal antibody (M01), clone 3G6

Ref: AB-H00054187-M01
NANS monoclonal antibody (M01), clone 3G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NANS.
Información adicional
Size 100 ug
Gene Name NANS
Gene Alias SAS
Gene Description N-acetylneuraminic acid synthase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NANS (NP_061819, 260 a.a. ~ 359 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54187
Clone Number 3G6
Iso type IgG2a Kappa

Enviar un mensaje


NANS monoclonal antibody (M01), clone 3G6

NANS monoclonal antibody (M01), clone 3G6