DCUN1D1 MaxPab rabbit polyclonal antibody (D01)
  • DCUN1D1 MaxPab rabbit polyclonal antibody (D01)

DCUN1D1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00054165-D01
DCUN1D1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DCUN1D1 protein.
Información adicional
Size 100 uL
Gene Name DCUN1D1
Gene Alias DCUN1L1|RP42|SCCRO|SCRO|Tes3
Gene Description DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DCUN1D1 (NP_065691.2, 1 a.a. ~ 259 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 54165

Enviar un mensaje


DCUN1D1 MaxPab rabbit polyclonal antibody (D01)

DCUN1D1 MaxPab rabbit polyclonal antibody (D01)