POLE3 polyclonal antibody (A01)
  • POLE3 polyclonal antibody (A01)

POLE3 polyclonal antibody (A01)

Ref: AB-H00054107-A01
POLE3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant POLE3.
Información adicional
Size 50 uL
Gene Name POLE3
Gene Alias CHARAC17|CHRAC17|YBL1|p17
Gene Description polymerase (DNA directed), epsilon 3 (p17 subunit)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POLE3 (AAH03166, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54107

Enviar un mensaje


POLE3 polyclonal antibody (A01)

POLE3 polyclonal antibody (A01)