TLR9 monoclonal antibody (M05), clone 2H5
  • TLR9 monoclonal antibody (M05), clone 2H5

TLR9 monoclonal antibody (M05), clone 2H5

Ref: AB-H00054106-M05
TLR9 monoclonal antibody (M05), clone 2H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TLR9.
Información adicional
Size 100 ug
Gene Name TLR9
Gene Alias CD289
Gene Description toll-like receptor 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,S-ELISA,ELISA
Immunogen Prot. Seq PPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TLR9 (AAH32713, 99 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54106
Clone Number 2H5
Iso type IgG2a Kappa

Enviar un mensaje


TLR9 monoclonal antibody (M05), clone 2H5

TLR9 monoclonal antibody (M05), clone 2H5