TLR9 monoclonal antibody (M01), clone 2D11
  • TLR9 monoclonal antibody (M01), clone 2D11

TLR9 monoclonal antibody (M01), clone 2D11

Ref: AB-H00054106-M01
TLR9 monoclonal antibody (M01), clone 2D11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TLR9.
Información adicional
Size 100 ug
Gene Name TLR9
Gene Alias CD289
Gene Description toll-like receptor 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq PPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TLR9 (AAH32713, 99 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54106
Clone Number 2D11
Iso type IgG1 Kappa

Enviar un mensaje


TLR9 monoclonal antibody (M01), clone 2D11

TLR9 monoclonal antibody (M01), clone 2D11