SETD4 MaxPab mouse polyclonal antibody (B01)
  • SETD4 MaxPab mouse polyclonal antibody (B01)

SETD4 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00054093-B01
SETD4 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human C21orf18 protein.
Información adicional
Size 50 uL
Gene Name SETD4
Gene Alias C21orf18|C21orf27
Gene Description SET domain containing 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQKGKGRTSRIRRRKLCGSSESRGVNESHKSEFIELRKWLKARKFQDSNLAPACFPGTGRGLMSQTSLQEGQMIISLPESCLLTTDTVIRSYLGAYITKWKPPPSPLLALCTFLVSEKHAGHRSLWKPYLEILPKAYTCPVCLEPEVVNLLPKSLKAKAEEQRAHVQEFFASSRDFFSSLQPLFAEAVDSIFSYSALLWAWCTVNTRAVYLRPRQRECLSAEPDTCALAPYLDLLNHSPHVQVKAAFNEETHSYE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SETD4 (NP_001007260.1, 1 a.a. ~ 307 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 54093

Enviar un mensaje


SETD4 MaxPab mouse polyclonal antibody (B01)

SETD4 MaxPab mouse polyclonal antibody (B01)