CSNK1G1 monoclonal antibody (M03), clone 3F10
  • CSNK1G1 monoclonal antibody (M03), clone 3F10

CSNK1G1 monoclonal antibody (M03), clone 3F10

Ref: AB-H00053944-M03
CSNK1G1 monoclonal antibody (M03), clone 3F10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CSNK1G1.
Información adicional
Size 100 ug
Gene Name CSNK1G1
Gene Alias -
Gene Description casein kinase 1, gamma 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,RNAi-Ab
Immunogen Prot. Seq KKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CSNK1G1 (AAH17236, 293 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 53944
Clone Number 3F10
Iso type IgG2a Kappa

Enviar un mensaje


CSNK1G1 monoclonal antibody (M03), clone 3F10

CSNK1G1 monoclonal antibody (M03), clone 3F10