DUOX1 polyclonal antibody (A01)
  • DUOX1 polyclonal antibody (A01)

DUOX1 polyclonal antibody (A01)

Ref: AB-H00053905-A01
DUOX1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DUOX1.
Información adicional
Size 50 uL
Gene Name DUOX1
Gene Alias LNOX1|MGC138840|MGC138841|NOXEF1|THOX1
Gene Description dual oxidase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VEVPEVIKDLCRRASYISQDMICPSPRVSARCSRSDIETELTPQRLQCPMDTDPPQEIRRRFGKKVTSFQPLLFTEAHREKFQRSCLH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DUOX1 (NP_059130, 941 a.a. ~ 1028 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 53905

Enviar un mensaje


DUOX1 polyclonal antibody (A01)

DUOX1 polyclonal antibody (A01)