MUCDHL polyclonal antibody (A01)
  • MUCDHL polyclonal antibody (A01)

MUCDHL polyclonal antibody (A01)

Ref: AB-H00053841-A01
MUCDHL polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MUCDHL.
Información adicional
Size 50 uL
Gene Name MUPCDH
Gene Alias FLJ20219|MU-PCDH|MUCDHL
Gene Description mucin-like protocadherin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AQYCSVNKDIFEVEENTNVTEPLVDIHVPEGQEVTLGALSTPFAFRIQGNQLFLNVTPDYEEKSLLEAQLLCQSGGTLVTQLRVFVSVLDVNDNAPEFP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MUCDHL (NP_068743, 27 a.a. ~ 125 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 53841

Enviar un mensaje


MUCDHL polyclonal antibody (A01)

MUCDHL polyclonal antibody (A01)