TRIM34 polyclonal antibody (A01)
  • TRIM34 polyclonal antibody (A01)

TRIM34 polyclonal antibody (A01)

Ref: AB-H00053840-A01
TRIM34 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TRIM34.
Información adicional
Size 50 uL
Gene Name TRIM34
Gene Alias IFP1|RNF21
Gene Description tripartite motif-containing 34
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SVPIWPFQCYNYGVLGSQYFSSGKHYWEVDVSKKTAWILGVYCRTYSRHMKYVVRRCANRQNLYTKYRPLFGYWVIGLQNKCKYGVFEESL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM34 (NP_067629, 325 a.a. ~ 415 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 53840

Enviar un mensaje


TRIM34 polyclonal antibody (A01)

TRIM34 polyclonal antibody (A01)