DSCR6 monoclonal antibody (M09), clone 1D1
  • DSCR6 monoclonal antibody (M09), clone 1D1

DSCR6 monoclonal antibody (M09), clone 1D1

Ref: AB-H00053820-M09
DSCR6 monoclonal antibody (M09), clone 1D1

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant DSCR6.
Información adicional
Size 100 ug
Gene Name DSCR6
Gene Alias RIPPLY3
Gene Description Down syndrome critical region gene 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MEPEAAAGARKARGRGCHCPGDAPWRPPPPRGPESPAPWRPWIQTPGDAELTRTGRPLEPRADQHTFGSKGAFGFQHPVRVYLPMSKRQEYLRSSGEQVLASFPVQATIDFYDDESTESASEAEEPEEGPPPLHLLPQEVGGRQENGPGGKGRDQGINQGQRSSGGGDHWGEGPLPQGVSSRGGKCSSSK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DSCR6 (NP_061835.1, 1 a.a. ~ 190 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 53820
Clone Number 1D1
Iso type IgG2b Kappa

Enviar un mensaje


DSCR6 monoclonal antibody (M09), clone 1D1

DSCR6 monoclonal antibody (M09), clone 1D1