PRKAG3 purified MaxPab rabbit polyclonal antibody (D01P)
  • PRKAG3 purified MaxPab rabbit polyclonal antibody (D01P)

PRKAG3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00053632-D01P
PRKAG3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PRKAG3 protein.
Información adicional
Size 100 ug
Gene Name PRKAG3
Gene Alias AMPKG3
Gene Description protein kinase, AMP-activated, gamma 3 non-catalytic subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEPGLEHALRRTPSWSSLGGSEHQEMSFLEQENSSSWPSPAVTSSSERIRGKRRAKALRWTRQKSVEEGEPPGQGEGPRSRPAAESTGLEATFPKTTPLAQADPAGVGTPPTGWDCLPSDCTASAAGSSTDDVELATEFPATEAWECELEGLLEERPALCLSPQAPFPKLGWDDELRKPGAQIYMRFMQEHTCYDAMATSSKLVIFDTMLEIKKAFFALVANGVRAAPLWDSKKQSFVGMLTITDFILVLHRYYR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRKAG3 (NP_059127.2, 1 a.a. ~ 489 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 53632

Enviar un mensaje


PRKAG3 purified MaxPab rabbit polyclonal antibody (D01P)

PRKAG3 purified MaxPab rabbit polyclonal antibody (D01P)