CLIC5 monoclonal antibody (M03), clone 1E6
  • CLIC5 monoclonal antibody (M03), clone 1E6

CLIC5 monoclonal antibody (M03), clone 1E6

Ref: AB-H00053405-M03
CLIC5 monoclonal antibody (M03), clone 1E6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CLIC5.
Información adicional
Size 100 ug
Gene Name CLIC5
Gene Alias CLIC5B|FLJ90663|MST130|MSTP130|dJ447E21.4
Gene Description chloride intracellular channel 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA,IF
Immunogen Prot. Seq FLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLIC5 (NP_058625.2, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 53405
Clone Number 1E6
Iso type IgG2a Kappa

Enviar un mensaje


CLIC5 monoclonal antibody (M03), clone 1E6

CLIC5 monoclonal antibody (M03), clone 1E6