PANK1 purified MaxPab mouse polyclonal antibody (B01P)
  • PANK1 purified MaxPab mouse polyclonal antibody (B01P)

PANK1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00053354-B01P
PANK1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PANK1 protein.
Información adicional
Size 50 ug
Gene Name PANK1
Gene Alias MGC24596|PANK|PANK1a|PANK1b
Gene Description pantothenate kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MKLINGKKQTFPWFGMDIGGTLVKLVYFEPKDITAEEEQEEVENLKSIRKYLTSNTAYGKTGIRDVHLELKNLTMCGRKGNLHFIRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFKFEEDFRMIADLQLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PANK1 (NP_683879.1, 1 a.a. ~ 373 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 53354

Enviar un mensaje


PANK1 purified MaxPab mouse polyclonal antibody (B01P)

PANK1 purified MaxPab mouse polyclonal antibody (B01P)