PANK1 polyclonal antibody (A01)
  • PANK1 polyclonal antibody (A01)

PANK1 polyclonal antibody (A01)

Ref: AB-H00053354-A01
PANK1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PANK1.
Información adicional
Size 50 uL
Gene Name PANK1
Gene Alias MGC24596|PANK|PANK1a|PANK1b
Gene Description pantothenate kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq IRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFKFEEDFRMIADLQLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PANK1 (NP_683878, 310 a.a. ~ 409 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 53354

Enviar un mensaje


PANK1 polyclonal antibody (A01)

PANK1 polyclonal antibody (A01)