UBASH3A monoclonal antibody (M25), clone 1G6
  • UBASH3A monoclonal antibody (M25), clone 1G6

UBASH3A monoclonal antibody (M25), clone 1G6

Ref: AB-H00053347-M25
UBASH3A monoclonal antibody (M25), clone 1G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UBASH3A.
Información adicional
Size 100 ug
Gene Name UBASH3A
Gene Alias CLIP4|STS-2|TULA
Gene Description ubiquitin associated and SH3 domain containing, A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLLGLPPRECGDFAQLVRKIPSLGMCFCEENKEEGKWELVNPPVKTLTHGANAAFNWRNWISGN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBASH3A (NP_001001895, 524 a.a. ~ 623 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 53347
Clone Number 1G6
Iso type IgG2b Kappa

Enviar un mensaje


UBASH3A monoclonal antibody (M25), clone 1G6

UBASH3A monoclonal antibody (M25), clone 1G6