SPA17 purified MaxPab mouse polyclonal antibody (B01P)
  • SPA17 purified MaxPab mouse polyclonal antibody (B01P)

SPA17 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00053340-B01P
SPA17 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SPA17 protein.
Información adicional
Size 50 ug
Gene Name SPA17
Gene Alias SP17|SP17-1
Gene Description sperm autoantigenic protein 17
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SPA17 (NP_059121.1, 1 a.a. ~ 151 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 53340

Enviar un mensaje


SPA17 purified MaxPab mouse polyclonal antibody (B01P)

SPA17 purified MaxPab mouse polyclonal antibody (B01P)