BCL11A polyclonal antibody (A01)
  • BCL11A polyclonal antibody (A01)

BCL11A polyclonal antibody (A01)

Ref: AB-H00053335-A01
BCL11A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BCL11A.
Información adicional
Size 50 uL
Gene Name BCL11A
Gene Alias BCL11A-L|BCL11A-S|BCL11A-XL|CTIP1|EVI9|FLJ10173|FLJ34997|HBFQTL5|KIAA1809|ZNF856
Gene Description B-cell CLL/lymphoma 11A (zinc finger protein)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BCL11A (NP_060484, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 53335

Enviar un mensaje


BCL11A polyclonal antibody (A01)

BCL11A polyclonal antibody (A01)