GALNT7 polyclonal antibody (A01)
  • GALNT7 polyclonal antibody (A01)

GALNT7 polyclonal antibody (A01)

Ref: AB-H00051809-A01
GALNT7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GALNT7.
Información adicional
Size 50 uL
Gene Name GALNT7
Gene Alias GALNAC-T7|GalNAcT7
Gene Description UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7 (GalNAc-T7)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LGPCHRMGGNQLFRINEANQLMQYDQCLTKGADGSKVMITHCNLNEFKEWQYFKNLHRFTHIPSGKCLDRSEVLHQVFISNCDSSKTTQKWEMNNIHSV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GALNT7 (NP_059119, 559 a.a. ~ 657 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51809

Enviar un mensaje


GALNT7 polyclonal antibody (A01)

GALNT7 polyclonal antibody (A01)