COQ3 purified MaxPab rabbit polyclonal antibody (D01P)
  • COQ3 purified MaxPab rabbit polyclonal antibody (D01P)

COQ3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051805-D01P
COQ3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human COQ3 protein.
Información adicional
Size 100 ug
Gene Name COQ3
Gene Alias UG0215E05|bA9819.1
Gene Description coenzyme Q3 homolog, methyltransferase (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MWSGRKLGSSGGWFLRVLGPGGCNTKAARPLISSAVYVKNQLSGTLQIKPGVFNEYRTIWFKSYRTIFSCLNRIKSFRYPWARLYSTSQTTVDSGEVKTFLALAHKWWDEQGVYAPLHSMNDLRVPFIRDNLLKTIPNHQPGKPLLGMKILDVGCGGGLLTEPLGRLGASVIGIDPVDENIKTAQCHKSFDPVLDKRIEYRVCSLEEIVEETAETFDAVVASEVVEHVIDLETFLQCCCQVLKPGGSLFITTINK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen COQ3 (AAH63463.1, 1 a.a. ~ 369 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51805

Enviar un mensaje


COQ3 purified MaxPab rabbit polyclonal antibody (D01P)

COQ3 purified MaxPab rabbit polyclonal antibody (D01P)