SIX4 monoclonal antibody (M05), clone 3B8
  • SIX4 monoclonal antibody (M05), clone 3B8

SIX4 monoclonal antibody (M05), clone 3B8

Ref: AB-H00051804-M05
SIX4 monoclonal antibody (M05), clone 3B8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SIX4.
Información adicional
Size 100 ug
Gene Name SIX4
Gene Alias AREC3|MGC119450|MGC119452|MGC119453
Gene Description SIX homeobox 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq GQDLLSVPMTQAALGEIVPTAEDQVGHPSPAVHQDFVQEHRLVLQSVANMKENFLSNSESKATSSLMMLDSKSKYVLDGMVDTVCEDLETDKKELAKLQTVQLDEDMQD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SIX4 (NP_059116, 672 a.a. ~ 780 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51804
Clone Number 3B8
Iso type IgG1 Kappa

Enviar un mensaje


SIX4 monoclonal antibody (M05), clone 3B8

SIX4 monoclonal antibody (M05), clone 3B8