SIX4 polyclonal antibody (A01)
  • SIX4 polyclonal antibody (A01)

SIX4 polyclonal antibody (A01)

Ref: AB-H00051804-A01
SIX4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SIX4.
Información adicional
Size 50 uL
Gene Name SIX4
Gene Alias AREC3|MGC119450|MGC119452|MGC119453
Gene Description SIX homeobox 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GQDLLSVPMTQAALGEIVPTAEDQVGHPSPAVHQDFVQEHRLVLQSVANMKENFLSNSESKATSSLMMLDSKSKYVLDGMVDTVCEDLETDKKELAKLQTVQLDEDMQD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SIX4 (NP_059116, 672 a.a. ~ 780 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51804

Enviar un mensaje


SIX4 polyclonal antibody (A01)

SIX4 polyclonal antibody (A01)