HBXAP monoclonal antibody (M05), clone 3E6
  • HBXAP monoclonal antibody (M05), clone 3E6

HBXAP monoclonal antibody (M05), clone 3E6

Ref: AB-H00051773-M05
HBXAP monoclonal antibody (M05), clone 3E6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HBXAP.
Información adicional
Size 100 ug
Gene Name RSF1
Gene Alias HBXAP|RSF-1|XAP8|p325
Gene Description remodeling and spacing factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq IESDEEEDFENVGKVGSPLDYSLVDLPSTNGQSPGKAIENLIGKPTEKSQTPKDNSTASASLASNGTSGGQEAGAPEEEEDELLRVTDLVDYVCNSEQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HBXAP (NP_057662.3, 1343 a.a. ~ 1441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51773
Clone Number 3E6
Iso type IgG2a Kappa

Enviar un mensaje


HBXAP monoclonal antibody (M05), clone 3E6

HBXAP monoclonal antibody (M05), clone 3E6