CRKRS monoclonal antibody (M04), clone 3C1
  • CRKRS monoclonal antibody (M04), clone 3C1

CRKRS monoclonal antibody (M04), clone 3C1

Ref: AB-H00051755-M04
CRKRS monoclonal antibody (M04), clone 3C1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CRKRS.
Información adicional
Size 100 ug
Gene Name CRKRS
Gene Alias CRK7|CRKR|KIAA0904
Gene Description Cdc2-related kinase, arginine/serine-rich
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA,IF
Immunogen Prot. Seq LVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRKRS (NP_057591, 1281 a.a. ~ 1380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51755
Clone Number 3C1
Iso type IgG2a Kappa

Enviar un mensaje


CRKRS monoclonal antibody (M04), clone 3C1

CRKRS monoclonal antibody (M04), clone 3C1