GHRL monoclonal antibody (M15), clone 2F2
  • GHRL monoclonal antibody (M15), clone 2F2

GHRL monoclonal antibody (M15), clone 2F2

Ref: AB-H00051738-M15
GHRL monoclonal antibody (M15), clone 2F2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant GHRL.
Información adicional
Size 100 ug
Gene Name GHRL
Gene Alias MTLRP|obestatin
Gene Description ghrelin/obestatin prepropeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GHRL (NP_057446, 24 a.a. ~ 117 a.a) full length recombinant protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51738
Clone Number 2F2
Iso type IgG2a Kappa

Enviar un mensaje


GHRL monoclonal antibody (M15), clone 2F2

GHRL monoclonal antibody (M15), clone 2F2