GHRL monoclonal antibody (M13), clone 3G3
  • GHRL monoclonal antibody (M13), clone 3G3

GHRL monoclonal antibody (M13), clone 3G3

Ref: AB-H00051738-M13
GHRL monoclonal antibody (M13), clone 3G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GHRL.
Información adicional
Size 100 ug
Gene Name GHRL
Gene Alias MTLRP|obestatin
Gene Description ghrelin/obestatin prepropeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq GSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GHRL (NP_057446, 24 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51738
Clone Number 3G3
Iso type IgG

Enviar un mensaje


GHRL monoclonal antibody (M13), clone 3G3

GHRL monoclonal antibody (M13), clone 3G3