GHRL monoclonal antibody (M05A), clone 2E2
  • GHRL monoclonal antibody (M05A), clone 2E2

GHRL monoclonal antibody (M05A), clone 2E2

Ref: AB-H00051738-M05A
GHRL monoclonal antibody (M05A), clone 2E2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant GHRL.
Información adicional
Size 200 uL
Gene Name GHRL
Gene Alias MTLRP|obestatin
Gene Description ghrelin/obestatin prepropeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GHRL (AAH25791.1, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 51738
Clone Number 2E2
Iso type IgG2a Kappa

Enviar un mensaje


GHRL monoclonal antibody (M05A), clone 2E2

GHRL monoclonal antibody (M05A), clone 2E2