GHRL polyclonal antibody (A02)
  • GHRL polyclonal antibody (A02)

GHRL polyclonal antibody (A02)

Ref: AB-H00051738-A02
GHRL polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GHRL.
Información adicional
Size 50 uL
Gene Name GHRL
Gene Alias MTLRP|obestatin
Gene Description ghrelin/obestatin prepropeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq GSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GHRL (NP_057446, 24 a.a. ~ 117 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51738

Enviar un mensaje


GHRL polyclonal antibody (A02)

GHRL polyclonal antibody (A02)