RAPGEF6 monoclonal antibody (M02), clone 3A9
  • RAPGEF6 monoclonal antibody (M02), clone 3A9

RAPGEF6 monoclonal antibody (M02), clone 3A9

Ref: AB-H00051735-M02
RAPGEF6 monoclonal antibody (M02), clone 3A9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAPGEF6.
Información adicional
Size 100 ug
Gene Name RAPGEF6
Gene Alias DKFZp667N084|DKFZp686I15116|KIA001LB|PDZ-GEF2|PDZGEF2|RA-GEF-2|RAGEF2
Gene Description Rap guanine nucleotide exchange factor (GEF) 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LFPVVKKDMTFLHEGNDSKVDGLVNFEKLRMISKEIRQVVRMTSANMDPAMMFRQRSLSQGSTNSNMLDVQGGAHKKRARRSSLLNAKKLYEDAQMARK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAPGEF6 (NP_057424, 1012 a.a. ~ 1110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51735
Clone Number 3A9
Iso type IgG2a Kappa

Enviar un mensaje


RAPGEF6 monoclonal antibody (M02), clone 3A9

RAPGEF6 monoclonal antibody (M02), clone 3A9