SEPX1 monoclonal antibody (M02), clone 8B2
  • SEPX1 monoclonal antibody (M02), clone 8B2

SEPX1 monoclonal antibody (M02), clone 8B2

Ref: AB-H00051734-M02
SEPX1 monoclonal antibody (M02), clone 8B2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SEPX1.
Información adicional
Size 100 ug
Gene Name SEPX1
Gene Alias HSPC270|MGC3344|MSRB1|SELR|SELX
Gene Description selenoprotein X, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEPX1 (NP_057416, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51734
Clone Number 8B2
Iso type IgG1 Kappa

Enviar un mensaje


SEPX1 monoclonal antibody (M02), clone 8B2

SEPX1 monoclonal antibody (M02), clone 8B2