POLR3K monoclonal antibody (M01), clone 3F5
  • POLR3K monoclonal antibody (M01), clone 3F5

POLR3K monoclonal antibody (M01), clone 3F5

Ref: AB-H00051728-M01
POLR3K monoclonal antibody (M01), clone 3F5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant POLR3K.
Información adicional
Size 100 ug
Gene Name POLR3K
Gene Alias C11|C11-RNP3|My010|RPC10|RPC11|hRPC11
Gene Description polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POLR3K (AAH11932, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51728
Clone Number 3F5
Iso type IgG1 Kappa

Enviar un mensaje


POLR3K monoclonal antibody (M01), clone 3F5

POLR3K monoclonal antibody (M01), clone 3F5