POLR3K polyclonal antibody (A01)
  • POLR3K polyclonal antibody (A01)

POLR3K polyclonal antibody (A01)

Ref: AB-H00051728-A01
POLR3K polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant POLR3K.
Información adicional
Size 50 uL
Gene Name POLR3K
Gene Alias C11|C11-RNP3|My010|RPC10|RPC11|hRPC11
Gene Description polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POLR3K (AAH11932, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51728

Enviar un mensaje


POLR3K polyclonal antibody (A01)

POLR3K polyclonal antibody (A01)