CAB39 purified MaxPab rabbit polyclonal antibody (D01P)
  • CAB39 purified MaxPab rabbit polyclonal antibody (D01P)

CAB39 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051719-D01P
CAB39 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CAB39 protein.
Información adicional
Size 100 ug
Gene Name CAB39
Gene Alias CGI-66|FLJ22682|MO25
Gene Description calcium binding protein 39
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPEN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CAB39 (NP_057373.1, 1 a.a. ~ 341 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51719

Enviar un mensaje


CAB39 purified MaxPab rabbit polyclonal antibody (D01P)

CAB39 purified MaxPab rabbit polyclonal antibody (D01P)