ZNF44 MaxPab mouse polyclonal antibody (B01P)
  • ZNF44 MaxPab mouse polyclonal antibody (B01P)

ZNF44 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051710-B01P
ZNF44 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF44 protein.
Información adicional
Size 50 ug
Gene Name ZNF44
Gene Alias DKFZp434F1811|DKFZp686L21136|GIOT-2|KOX7|ZNF|ZNF504|ZNF55|ZNF58
Gene Description zinc finger protein 44
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MALCYGTFWGYPKMLEAANLMEGLVDIGPWVTLPRGQPEVLEWGLPKDQDSVAFEDVAVNFTHEEWALLGPSQKNLYRDVMRETIRNLNCIGMKWENQNIDDQHQNLRRNPRLSETWLQNFILIHYGHLVALSDGGLLQFSTGQGLPVTQAGVQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF44 (AAH32246.1, 1 a.a. ~ 154 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51710

Enviar un mensaje


ZNF44 MaxPab mouse polyclonal antibody (B01P)

ZNF44 MaxPab mouse polyclonal antibody (B01P)