GPRC5B monoclonal antibody (M04), clone 1H1
  • GPRC5B monoclonal antibody (M04), clone 1H1

GPRC5B monoclonal antibody (M04), clone 1H1

Ref: AB-H00051704-M04
GPRC5B monoclonal antibody (M04), clone 1H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GPRC5B.
Información adicional
Size 100 ug
Gene Name GPRC5B
Gene Alias RAIG-2|RAIG2
Gene Description G protein-coupled receptor, family C, group 5, member B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHLW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GPRC5B (NP_057319.1, 302 a.a. ~ 403 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51704
Clone Number 1H1
Iso type IgG1 Kappa

Enviar un mensaje


GPRC5B monoclonal antibody (M04), clone 1H1

GPRC5B monoclonal antibody (M04), clone 1H1