CPSF3 monoclonal antibody (M01), clone 6E6
  • CPSF3 monoclonal antibody (M01), clone 6E6

CPSF3 monoclonal antibody (M01), clone 6E6

Ref: AB-H00051692-M01
CPSF3 monoclonal antibody (M01), clone 6E6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CPSF3.
Información adicional
Size 100 ug
Gene Name CPSF3
Gene Alias CPSF|CPSF-73|CPSF73|YSH1
Gene Description cleavage and polyadenylation specific factor 3, 73kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq LEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEALTPVH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CPSF3 (NP_057291, 585 a.a. ~ 684 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51692
Clone Number 6E6
Iso type IgG2a Kappa

Enviar un mensaje


CPSF3 monoclonal antibody (M01), clone 6E6

CPSF3 monoclonal antibody (M01), clone 6E6