TPPP3 purified MaxPab mouse polyclonal antibody (B02P)
  • TPPP3 purified MaxPab mouse polyclonal antibody (B02P)

TPPP3 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00051673-B02P
TPPP3 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TPPP3 protein.
Información adicional
Size 50 ug
Gene Name TPPP3
Gene Alias CGI-38|p20|p25gamma
Gene Description tubulin polymerization-promoting protein family member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TPPP3 (NP_057048.2, 1 a.a. ~ 176 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51673

Enviar un mensaje


TPPP3 purified MaxPab mouse polyclonal antibody (B02P)

TPPP3 purified MaxPab mouse polyclonal antibody (B02P)