ASB4 monoclonal antibody (M01), clone 2G11
  • ASB4 monoclonal antibody (M01), clone 2G11

ASB4 monoclonal antibody (M01), clone 2G11

Ref: AB-H00051666-M01
ASB4 monoclonal antibody (M01), clone 2G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ASB4.
Información adicional
Size 100 ug
Gene Name ASB4
Gene Alias ASB-4|MGC142039|MGC142041
Gene Description ankyrin repeat and SOCS box-containing 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq VTSVRPAAQPEICYQLLLNHGAARIYPPQFHKVIQACHSCPKAIEVVVNAYEHIRWNTKWRRAIPDDDLEKYWDFYHSLFTVCCNSPRTLMHLSRCAIRRTLHNRCHRA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ASB4 (NP_057200, 295 a.a. ~ 403 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51666
Clone Number 2G11
Iso type IgG2a Kappa

Enviar un mensaje


ASB4 monoclonal antibody (M01), clone 2G11

ASB4 monoclonal antibody (M01), clone 2G11