Ver mas grande
FKBP7 purified MaxPab mouse polyclonal antibody (B02P)
AB-H00051661-B02P
Producto nuevo
FKBP7 purified MaxPab mouse polyclonal antibody (B02P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | FKBP7 |
| Gene Alias | FKBP23|MGC9420|PPIase |
| Gene Description | FK506 binding protein 7 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Tr |
| Immunogen Prot. Seq | MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | FKBP7 (NP_851939.1, 1 a.a. ~ 222 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 51661 |
Más información
Mouse polyclonal antibody raised against a full-length human FKBP7 protein.