STYXL1 MaxPab mouse polyclonal antibody (B01P)
  • STYXL1 MaxPab mouse polyclonal antibody (B01P)

STYXL1 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051657-B01P
STYXL1 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human STYXL1 protein.
Información adicional
Size 50 ug
Gene Name STYXL1
Gene Alias DUSP24|MK-STYX
Gene Description serine/threonine/tyrosine interacting-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STYXL1 (AAH24035.1, 1 a.a. ~ 313 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51657

Enviar un mensaje


STYXL1 MaxPab mouse polyclonal antibody (B01P)

STYXL1 MaxPab mouse polyclonal antibody (B01P)