RASD1 monoclonal antibody (M01), clone 2D12
  • RASD1 monoclonal antibody (M01), clone 2D12

RASD1 monoclonal antibody (M01), clone 2D12

Ref: AB-H00051655-M01
RASD1 monoclonal antibody (M01), clone 2D12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RASD1.
Información adicional
Size 100 ug
Gene Name RASD1
Gene Alias AGS1|DEXRAS1|MGC:26290
Gene Description RAS, dexamethasone-induced 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,IF
Immunogen Prot. Seq MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RASD1 (AAH18041, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51655
Clone Number 2D12
Iso type IgG2a Kappa

Enviar un mensaje


RASD1 monoclonal antibody (M01), clone 2D12

RASD1 monoclonal antibody (M01), clone 2D12