BIT1 MaxPab mouse polyclonal antibody (B01P)
  • BIT1 MaxPab mouse polyclonal antibody (B01P)

BIT1 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051651-B01P
BIT1 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BIT1 protein.
Información adicional
Size 50 ug
Gene Name PTRH2
Gene Alias BIT1|CGI-147|FLJ32471|PTH2
Gene Description peptidyl-tRNA hydrolase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BIT1 (AAH06807, 1 a.a. ~ 179 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51651

Enviar un mensaje


BIT1 MaxPab mouse polyclonal antibody (B01P)

BIT1 MaxPab mouse polyclonal antibody (B01P)