TAF9B purified MaxPab mouse polyclonal antibody (B01P)
  • TAF9B purified MaxPab mouse polyclonal antibody (B01P)

TAF9B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051616-B01P
TAF9B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TAF9B protein.
Información adicional
Size 50 ug
Gene Name TAF9B
Gene Alias DN-7|DN7|TAF9L|TAFII31L|TFIID-31
Gene Description TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPATTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TAF9B (NP_057059.2, 1 a.a. ~ 251 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51616

Enviar un mensaje


TAF9B purified MaxPab mouse polyclonal antibody (B01P)

TAF9B purified MaxPab mouse polyclonal antibody (B01P)