PIGT monoclonal antibody (M01), clone 2A2
  • PIGT monoclonal antibody (M01), clone 2A2

PIGT monoclonal antibody (M01), clone 2A2

Ref: AB-H00051604-M01
PIGT monoclonal antibody (M01), clone 2A2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PIGT.
Información adicional
Size 100 ug
Gene Name PIGT
Gene Alias CGI-06|FLJ41596|MGC8909|NDAP
Gene Description phosphatidylinositol glycan anchor biosynthesis, class T
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq EPPRDSLREELVITPLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKALGQLISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWFQDTVTDV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIGT (NP_057021.2, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51604
Clone Number 2A2
Iso type IgG2a Kappa

Enviar un mensaje


PIGT monoclonal antibody (M01), clone 2A2

PIGT monoclonal antibody (M01), clone 2A2