ARS2 purified MaxPab mouse polyclonal antibody (B02P)
  • ARS2 purified MaxPab mouse polyclonal antibody (B02P)

ARS2 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00051593-B02P
ARS2 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ARS2 protein.
Información adicional
Size 50 ug
Gene Name ARS2
Gene Alias ASR2|MGC126427
Gene Description arsenate resistance protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MRRDWDEHSSDPYHSGYEMPYAGGGGGPTYGPPQPWGHPDVHIMQHHVLPIQARLGSIAEIDLGVPPPVMKTFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDEVGKRRQEARGALQNRLRVFLSLMETGWFDNLLLDIDKADAIVKMLDAAVIKMEGGTENDLRILEQEEEEEQAGKPGEPSKKEEGRAGAGLGDGERKTNDKDEKKEDGKQAENDSSNDDKTKKSEGDGDK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARS2 (NP_877952, 1 a.a. ~ 796 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51593

Enviar un mensaje


ARS2 purified MaxPab mouse polyclonal antibody (B02P)

ARS2 purified MaxPab mouse polyclonal antibody (B02P)