PCQAP monoclonal antibody (M02), clone 4A4
  • PCQAP monoclonal antibody (M02), clone 4A4

PCQAP monoclonal antibody (M02), clone 4A4

Ref: AB-H00051586-M02
PCQAP monoclonal antibody (M02), clone 4A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCQAP.
Información adicional
Size 100 ug
Gene Name MED15
Gene Alias ARC105|CAG7A|CTG7A|DKFZp686A2214|DKFZp762B1216|FLJ42282|FLJ42935|PCQAP|TIG-1|TIG1|TNRC7
Gene Description mediator complex subunit 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCQAP (NP_056973, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51586
Clone Number 4A4
Iso type IgG2a Kappa

Enviar un mensaje


PCQAP monoclonal antibody (M02), clone 4A4

PCQAP monoclonal antibody (M02), clone 4A4