AZIN1 purified MaxPab rabbit polyclonal antibody (D01P)
  • AZIN1 purified MaxPab rabbit polyclonal antibody (D01P)

AZIN1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051582-D01P
AZIN1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human AZIN1 protein.
Información adicional
Size 100 ug
Gene Name AZIN1
Gene Alias MGC3832|MGC691|OAZI|OAZIN|ODC1L
Gene Description antizyme inhibitor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQNVVAQIKPFYTVKCNSAPAVLEILAALGTGFACSSKNEMALVQELGVPPENIIYISPCKQVSQIKYAAKVGVNILTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYVHALSDARCVFDMAGEIGFTMNMLDIGGGFTGTEFQLEEVNHVISPL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AZIN1 (NP_056962.2, 1 a.a. ~ 448 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51582

Enviar un mensaje


AZIN1 purified MaxPab rabbit polyclonal antibody (D01P)

AZIN1 purified MaxPab rabbit polyclonal antibody (D01P)